PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma20g01260.1
Common NameZOSMA_20G01260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family bHLH
Protein Properties Length: 89aa    MW: 10136.6 Da    PI: 9.7837
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma20g01260.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH201.3e-0617551654
                     HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                      N+ + +L++llP++ + +  + s + +L++++ YIk+L
  Zosma20g01260.1 17 TNELIYKLQSLLPESRRRSTNRASTSKVLKETCIYIKNL 55
                     6999**********64555556***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.57E-71778IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.7E-81873IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MSGRRASGLK MITDEETNEL IYKLQSLLPE SRRRSTNRAS TSKVLKETCI YIKNLHREVD  60
DLSDRLSNLI ESMDRNSAQA EIIRGLLR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917019.12e-35PREDICTED: transcription factor ILI5-like
SwissprotA2X9L81e-32ILI5_ORYSI; Transcription factor ILI5
SwissprotQ6YUX01e-32ILI5_ORYSJ; Transcription factor ILI5
TrEMBLA0A0K9PKT55e-57A0A0K9PKT5_Z
STRINGMLOC_55094.14e-34(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92838145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-23bHLH family protein